PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_11912.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 650aa    MW: 71014.5 Da    PI: 5.2095
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_11912.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1391.7e-12189249262
                              XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                              ++ ++  r+++NRe+A+ sRqRKk ++eeLeekv ++ +  ++L  +++    e a+l+++
  Rsa1.0_11912.1_g00002.1 189 EDERKRARLIRNRESAQLSRQRKKHYVEELEEKVRSMHSAITDLNGKISYFMAENAALRQQ 249
                              55566779****************************************9999999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.9E-16188252IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.208190250IPR004827Basic-leucine zipper domain
PfamPF001709.6E-11191250IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.5E-16192250No hitNo description
SuperFamilySSF579593.38E-12192250No hitNo description
CDDcd147047.82E-21193244No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 650 aa     Download sequence    Send to blast
MAESITEEPP PPPAPPSEFD SISIPPFDQS HHPTSDQTPI GELMSDLGFP IDPDFELTFD  60
GMEDLYLPAE DETFLIPDNA SSQEHFGDFT PPEESQGSGT SFPDDDRCFS GDDERKLDQP  120
TPLSSQGSDN CCSDVPEGVD QKVKVEEAAA TTKRKKEDTS ESDESRSSKY RRSGEQESAV  180
TNIEEEGEED ERKRARLIRN RESAQLSRQR KKHYVEELEE KVRSMHSAIT DLNGKISYFM  240
AENAALRQQL GGCPPPPMGM YPPMAYPWMP CPPPYMVKQQ GGQVPLIPIP RLKPQNTLGS  300
SKGKSKKSEA RTKKVASISF LGLLFCLFLF GALSPIVNVD YGGISGAFYG NYRSSYVTDQ  360
VVYNQHRNRV LDTSRRDSAT ESSVPPGNGS EPLAASLFVP RNDKLVKIDG NLIINSILAS  420
EKAVASRKAS ESNESSKADG VIPKDRSLAL PLPDVGMIED MAKHLIRTKA EKQKALSSGS  480
ADTLNDSIKT KAANGEMQQW FREGVAGPMF SSGMCTEVFQ FDVSSTSGAI IPASPATNVS  540
SEHRKNATDT HRRKNRRTLR GLAIPLPGSD FNFTKEHQRN SSSKEIKPAS SMVVSVLVDP  600
REGGDGDIDG MIGGPKSLSR VFVVVLQDSA KYVTYSCALP RPGAPHLVTT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013687770.10.0PREDICTED: bZIP transcription factor 17-like
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLA0A0D3C5J60.0A0A0D3C5J6_BRAOL; Uncharacterized protein
STRINGscaffold_402899.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein